PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta000583
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family HD-ZIP
Protein Properties Length: 304aa    MW: 34584.6 Da    PI: 4.8523
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-3682PU_refplantGDBView CDS
gnl|UG|Pta#S20930502PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-1887140356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k++++t eq+++Le+ Fe+ +++  e++ +LAk lgL+ rq+ vWFqNrRa++k
  Pta000583  87 KKRRLTLEQVRALEKNFEMANKLEPEKKMQLAKALGLQPRQIAVWFQNRRARWK 140
                45689************************************************9 PP

2HD-ZIP_I/II127.26.9e-4186177192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl+ eqv++LE++Fe+ +kLepe+K++la++Lglqprq+avWFqnrRAR+ktkqlEkd++ Lk+ yd+lk++ ++L +e+++L++ ++
    Pta000583  86 EKKRRLTLEQVRALEKNFEMANKLEPEKKMQLAKALGLQPRQIAVWFQNRRARWKTKQLEKDFNILKHDYDSLKQNYDNLMEENNNLQAMIE 177
                  69**************************************************************************************8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.67E-1978144IPR009057Homeodomain-like
SMARTSM003893.6E-1785146IPR001356Homeobox domain
PROSITE profilePS5007116.84486142IPR001356Homeobox domain
CDDcd000863.46E-1687143No hitNo description
PfamPF000466.6E-1687140IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.4E-2089149IPR009057Homeodomain-like
PRINTSPR000311.6E-5113122IPR000047Helix-turn-helix motif
PROSITE patternPS000270117140IPR017970Homeobox, conserved site
PRINTSPR000311.6E-5122138IPR000047Helix-turn-helix motif
PfamPF021838.7E-14142183IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MACDRSALYP SNVIMNTEDN SSANAIAAMI ANSCTPPATF QGNRSMTVFE TGNERKRPAG  60
NSYSALELSD DIGDEDGSDD CIHLGEKKRR LTLEQVRALE KNFEMANKLE PEKKMQLAKA  120
LGLQPRQIAV WFQNRRARWK TKQLEKDFNI LKHDYDSLKQ NYDNLMEENN NLQAMIERLR  180
NKSQSCHDQK FQANSSKLQK DDQDLPILMM SATKVCANKE NNNEGRSSIG SEGSSVLDMD  240
SPSTIESQQN IDSVGFSNVK ARDPRLECNF RPKVEESVIE ADEPCNYLFY NNMESGPLLW  300
EYNW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134142RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.123470.0root| shoot| xylem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ8LC031e-49ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA9NV370.0A9NV37_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.15e-43HD-ZIP family protein